General Information

  • ID:  hor006405
  • Uniprot ID:  P18908
  • Protein name:  Atrial natriuretic factor
  • Gene name:  NPPA
  • Organism:  Gallus gallus (Chicken)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria , Theropoda , Saurischia , Dinosauria , Archosauria , Archelosauria , Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0009792 embryo development ending in birth or egg hatching; GO:0019934 cGMP-mediated signaling; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  MMRDSGCFGRRIDRIGSLSGMGCNGSRKN
  • Length:  29
  • Propeptide:  MDTRGSFSCGFLLLLLIQLQPSRANPIYNLSPAKELASMEALLERLEDKFALIEALESNPDLQEPQTQEEIPPELTDDSDEQKAEPKLASNTPLSYRNPFLKRLRGVQMPRMMRDSGCFGRRIDRIGSLSGMGCNGSRKN
  • Signal peptide:  MDTRGSFSCGFLLLLLIQLQPSRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3 (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-23
  • Structure ID:  AF-P18908-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006405_AF2.pdbhor006405_ESM.pdb

Physical Information

Mass: 366225 Formula: C124H213N47O40S5
Absent amino acids: AEHPQTVWY Common amino acids: G
pI: 11.25 Basic residues: 6
Polar residues: 14 Hydrophobic residues: 4
Hydrophobicity: -67.93 Boman Index: -9148
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 40.34
Instability Index: 3131.38 Extinction Coefficient cystines: 125
Absorbance 280nm: 4.46

Literature

  • PubMed ID:  1826483
  • Title:  Cloning and sequence analysis of complementary DNA encoding a precursor for chicken natriuretic peptide.
  • PubMed ID:  2972278
  • Title:  Identification of a 29-amino acid natriuretic peptide in chicken heart.